Leta i den här bloggen

söndag 21 augusti 2016

Zikavirusgenomi (sitaatti)

Tämä on pitkä sitaatti PubMed Genomi Zika viruksesta, mutta on syytä ottaa insiktin herättämisen  takia esiin.

Zika virus, complete genome

NCBI Reference Sequence: NC_012532.1

LOCUS       NC_012532              10794 bp    RNA     linear   VRL 08-FEB-2016
DEFINITION  Zika virus, complete genome.
ACCESSION   NC_012532
VERSION     NC_012532.1  GI:226377833
DBLINK      BioProject: PRJNA36615
KEYWORDS    RefSeq.
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10794)
  AUTHORS   Kuno,G. and Chang,G.-J.J.
  TITLE     Full-length sequencing and genomic characterization of Bagaza,
            Kedougou, and Zika viruses
  JOURNAL   Arch Virol. 152 (4), 687-696 (2007)
   PUBMED   17195954
REFERENCE   2  (bases 1 to 10794)
  AUTHORS   Kuno,G. and Chang,G.J.
  TITLE     Biological transmission of arboviruses: reexamination of and new
            insights into components, mechanisms, and unique traits as well as
            their evolutionary trends
  JOURNAL   Clin. Microbiol. Rev. 18 (4), 608-637 (2005)
   PUBMED   16223950
REFERENCE   3  (bases 1 to 10794)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 10794)
  AUTHORS   Kuno,G. and Chang,G.-J.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Division of Vector-Borne Infect. Dis., CDC,
            P.O. Box 2087, Fort Collins, CO 80522-2087, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 10794)
  AUTHORS   Kuno,G., Chang,G.-J.J. and Tsuchiya,K.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2004) Arbovirus Diseases Branch, Division of
            Vector-Borne Infectious Diseases, Centers for Disease Control and
            Prevention, P.O. Box 2087, Fort Collins, CO 80522, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY632535.
            Mature peptides were annotated by RefSeq staff using the cleavage
            sites reported in Kuno and Chang, 2007 (PMID 17195954). Questions
            about the annotation of this sequence should be directed to
            info@ncbi.nlm.nih.gov.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10794
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="MR 766"
                     /host="sentinel monkey"
                     /db_xref="taxon:64320"
                     /country="Uganda"
                     /note="mosquito-borne flavivirus"
     5'UTR           1..106
     gene            107..10366
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /db_xref="GeneID:7751225"
     CDS             107..10366
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /codon_start=1
                     /product="flavivirus polyprotein"
                     /protein_id="YP_002790881.1"
                     /db_xref="GI:226377834"
                     /db_xref="GeneID:7751225"
                     /translation="MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPI
                     RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKERK
                     RRGADTSIGIIGLLLTTAMAAEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQI
                     MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT
                     LPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIAWLLGSSTSQKV
                     IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE
                     LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG
                     NGCGLFGKGSLVTCAKFTCSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIGYETDEDR
                     AKVEVTPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIP
                     LPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGA
                     KGRLFSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKVPAETLHGTVTVEVQYAGTDGP
                     CKIPVQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGDKKI
                     THHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGVFNSLGKGIHQIFGAAFK
                     SLFGGMSWFSQILIGTLLVWLGLNTKNGSISLTCLALGGVMIFLSTAVSADVGCSVDF
                     SKKETRCGTGVFIYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEEGICGISSVSRMENI
                     MWKSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFV
                     RAAKTNNSFVVDGDTLKECPLEHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPA
                     VIGTAVKGREAAHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGVEESD
                     LIIPKSLAGPLSHHNTREGYRTQVKGPWHSEELEIRFEECPGTKVYVEETCGTRGPSL
                     RSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTD
                     HMDHFSLGVLVILLMVQEGLKKRMTTKIIMSTSMAVLVVMILGGFSMSDLAKLVILMG
                     ATFAEMNTGGDVAHLALVAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISA
                     LEGDLMVLINGFALAWLAIRAMAVPRTDNIALPILAALTPLARGTLLVAWRAGLATCG
                     GIMLLSLKGKGSVKKNLPFVMALGLTAVRVVDPINVVGLLLLTRSGKRSWPPSEVLTA
                     VGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVT
                     GNSPRLDVALDESGDFSLVEEDGPPMREIILKVVLMAICGMNPIAIPFAAGAWYVYVK
                     TGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTK
                     GAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTL
                     PGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
                     EEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKKRLRTVILAPTRVV
                     AAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLNIMDE
                     AHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERA
                     WSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKNQE
                     WDFVITTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRI
                     GRNPNKPGDEYMYGGGCAETDEGHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAI
                     EGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSV
                     PAEVWTKYGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAALGVMEALGTLPGHM
                     TERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFVLMRN
                     KGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSPQDNQ
                     MAIIIMVAVGLLGLITANELGWLERTKNDIAHLMGRREEGATMGFSMDIDLRPASAWA
                     IYAALTTLITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFMHGDLGVPLLMMG
                     CYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIVVTDI
                     DTMTIDPQVEKKMGQVLLIAVAISSAVLLRTAWGWGEAGALITAATSTLWEGSPNKYW
                     NSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQMSAL
                     EFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKIRWLEERGYLQPYGKVVDL
                     GCGRGGWSYYAATIRKVQEVRGYTKGGPGHEEPMLVQSYGWNIVRLKSGVDVFHMAAE
                     PCDTLLCDIGESSSSPEVEETRTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETME
                     RLQRRHGGGLVRVPLCRNSTHEMYWVSGAKSNIIKSVSTTSQLLLGRMDGPRRPVKYE
                     EDVNLGSGTRAVASCAEAPNMKIIGRRIERIRNEHAETWFLDENHPYRTWAYHGSYEA
                     PTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPDPQEG
                     TRQVMNIVSSWLWKELGKRKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVN
                     DPRFWALVDREREHHLRGECHSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLE
                     FEALGFLNEDHWMGRENSGGGVEGLGLQRLGYILEEMNRAPGGKMYADDTAGWDTRIS
                     KFDLENEALITNQMEEGHRTLALAVIKYTYQNKVVKVLRPAEGGKTVMDIISRQDQRG
                     SGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRKPEKVTRWLQSNGWDRLKRM
                     AVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWSNWEEVPFCSHHFNKL
                     YLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRL
                     MANAICSAVPVDWVPTGRTTWSIHGKGEWMTTEDMLMVWNRVWIEENDHMEDKTPVTK
                     WTDIPYLGKREDLWCGSLIGHRPRTTWAENIKDTVNMVRRIIGDEEKYMDYLSTQVRY
                     LGEEGSTPGVL"
     mat_peptide     107..472
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="anchored capsid protein C"
                     /protein_id="YP_009227206.1"
                     /db_xref="GI:985757037"
     mat_peptide     107..418
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="capsid protein C"
                     /protein_id="YP_009227196.1"
                     /db_xref="GI:985757027"
     mat_peptide     473..976
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="membrane glycoprotein precursor M"
                     /protein_id="YP_009227197.1"
                     /db_xref="GI:985757028"
     mat_peptide     473..751
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="protein pr"
                     /protein_id="YP_009227207.1"
                     /db_xref="GI:985757038"
     mat_peptide     752..976
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="membrane glycoprotein M"
                     /protein_id="YP_009227208.1"
                     /db_xref="GI:985757039"
     mat_peptide     977..2476
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="envelope protein E"
                     /protein_id="YP_009227198.1"
                     /db_xref="GI:985757029"
     mat_peptide     2477..3532
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS1"
                     /protein_id="YP_009227199.1"
                     /db_xref="GI:985757030"
     mat_peptide     3533..4210
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS2A"
                     /protein_id="YP_009227200.1"
                     /db_xref="GI:985757031"
     mat_peptide     4211..4600
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS2B"
                     /protein_id="YP_009227201.1"
                     /db_xref="GI:985757032"
     mat_peptide     4601..6451
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS3"
                     /protein_id="YP_009227202.1"
                     /db_xref="GI:985757033"
     mat_peptide     6452..6832
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS4A"
                     /protein_id="YP_009227203.1"
                     /db_xref="GI:985757034"
     mat_peptide     6833..6901
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="protein 2K"
                     /protein_id="YP_009227209.1"
                     /db_xref="GI:985757040"
     mat_peptide     6902..7654
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="nonstructural protein NS4B"
                     /protein_id="YP_009227204.1"
                     /db_xref="GI:985757035"
     mat_peptide     7655..10363
                     /gene="flavivirus polyprotein gene"
                     /locus_tag="ZIKV_gp1"
                     /product="RNA-dependent RNA polymerase NS5"
                     /protein_id="YP_009227205.1"
                     /db_xref="GI:985757036"
     3'UTR           10367..10794
ORIGIN      
        1 agttgttgat ctgtgtgagt cagactgcga cagttcgagt ctgaagcgag agctaacaac
       61 agtatcaaca ggtttaattt ggatttggaa acgagagttt ctggtcatga aaaaccccaa
      121 agaagaaatc cggaggatcc ggattgtcaa tatgctaaaa cgcggagtag cccgtgtaaa
      181 ccccttggga ggtttgaaga ggttgccagc cggacttctg ctgggtcatg gacccatcag
      241 aatggttttg gcgatactag cctttttgag atttacagca atcaagccat cactgggcct
      301 tatcaacaga tggggttccg tggggaaaaa agaggctatg gaaataataa agaagttcaa
      361 gaaagatctt gctgccatgt tgagaataat caatgctagg aaagagagga agagacgtgg
      421 cgcagacacc agcatcggaa tcattggcct cctgctgact acagccatgg cagcagagat
      481 cactagacgc gggagtgcat actacatgta cttggatagg agcgatgccg ggaaggccat
      541 ttcgtttgct accacattgg gagtgaacaa gtgccacgta cagatcatgg acctcgggca
      601 catgtgtgac gccaccatga gttatgagtg ccctatgctg gatgagggag tggaaccaga
      661 tgatgtcgat tgctggtgca acacgacatc aacttgggtt gtgtacggaa cctgtcatca
      721 caaaaaaggt gaggcacggc gatctagaag agccgtgacg ctcccttctc actctacaag
      781 gaagttgcaa acgcggtcgc agacctggtt agaatcaaga gaatacacga agcacttgat
      841 caaggttgaa aactggatat tcaggaaccc cgggtttgcg ctagtggccg ttgccattgc
      901 ctggcttttg ggaagctcga cgagccaaaa agtcatatac ttggtcatga tactgctgat
      961 tgccccggca tacagtatca ggtgcattgg agtcagcaat agagacttcg tggagggcat
     1021 gtcaggtggg acctgggttg atgttgtctt ggaacatgga ggctgcgtta ccgtgatggc
     1081 acaggacaag ccaacagtcg acatagagtt ggtcacgacg acggttagta acatggccga
     1141 ggtaagatcc tattgctacg aggcatcgat atcggacatg gcttcggaca gtcgttgccc
     1201 aacacaaggt gaagcctacc ttgacaagca atcagacact caatatgtct gcaaaagaac
     1261 attagtggac agaggttggg gaaacggttg tggacttttt ggcaaaggga gcttggtgac
     1321 atgtgccaag tttacgtgtt ctaagaagat gaccgggaag agcattcaac cggaaaatct
     1381 ggagtatcgg ataatgctat cagtgcatgg ctcccagcat agcgggatga ttggatatga
     1441 aactgacgaa gatagagcga aagtcgaggt tacgcctaat tcaccaagag cggaagcaac
     1501 cttgggaggc tttggaagct taggacttga ctgtgaacca aggacaggcc ttgacttttc
     1561 agatctgtat tacctgacca tgaacaataa gcattggttg gtgcacaaag agtggtttca
     1621 tgacatccca ttgccttggc atgctggggc agacaccgga actccacact ggaacaacaa
     1681 agaggcattg gtagaattca aggatgccca cgccaagagg caaaccgtcg tcgttctggg
     1741 gagccaggaa ggagccgttc acacggctct cgctggagct ctagaggctg agatggatgg
     1801 tgcaaaggga aggctgttct ctggccattt gaaatgccgc ctaaaaatgg acaagcttag
     1861 attgaagggc gtgtcatatt ccttgtgcac tgcggcattc acattcacca aggtcccagc
     1921 tgaaacactg catggaacag tcacagtgga ggtgcagtat gcagggacag atggaccctg
     1981 caagatccca gtccagatgg cggtggacat gcagaccctg accccagttg gaaggctgat
     2041 aaccgccaac cccgtgatta ctgaaagcac tgagaactca aagatgatgt tggagcttga
     2101 cccaccattt ggggattctt acattgtcat aggagttggg gacaagaaaa tcacccacca
     2161 ctggcatagg agtggtagca ccatcggaaa ggcatttgag gccactgtga gaggcgccaa
     2221 gagaatggca gtcctggggg atacagcctg ggacttcgga tcagtcgggg gtgtgttcaa
     2281 ctcactgggt aagggcattc accagatttt tggagcagcc ttcaaatcac tgtttggagg
     2341 aatgtcctgg ttctcacaga tcctcatagg cacgctgcta gtgtggttag gtttgaacac
     2401 aaagaatgga tctatctccc tcacatgctt ggccctgggg ggagtgatga tcttcctctc
     2461 cacggctgtt tctgctgacg tggggtgctc agtggacttc tcaaaaaagg aaacgagatg
     2521 tggcacgggg gtattcatct ataatgatgt tgaagcctgg agggaccggt acaagtacca
     2581 tcctgactcc ccccgcagat tggcagcagc agtcaagcag gcctgggaag aggggatctg
     2641 tgggatctca tccgtttcaa gaatggaaaa catcatgtgg aaatcagtag aaggggagct
     2701 caatgctatc ctagaggaga atggagttca actgacagtt gttgtgggat ctgtaaaaaa
     2761 ccccatgtgg agaggtccac aaagattgcc agtgcctgtg aatgagctgc cccatggctg
     2821 gaaagcctgg gggaaatcgt attttgttag ggcggcaaag accaacaaca gttttgttgt
     2881 cgacggtgac acactgaagg aatgtccgct tgagcacaga gcatggaata gttttcttgt
     2941 ggaggatcac gggtttggag tcttccacac cagtgtctgg cttaaggtca gagaagatta
     3001 ctcattagaa tgtgacccag ccgtcatagg aacagctgtt aagggaaggg aggccgcgca
     3061 cagtgatctg ggctattgga ttgaaagtga aaagaatgac acatggaggc tgaagagggc
     3121 ccacctgatt gagatgaaaa catgtgaatg gccaaagtct cacacattgt ggacagatgg
     3181 agtagaagaa agtgatctta tcatacccaa gtctttagct ggtccactca gccaccacaa
     3241 caccagagag ggttacagaa cccaagtgaa agggccatgg cacagtgaag agcttgaaat
     3301 ccggtttgag gaatgtccag gcaccaaggt ttacgtggag gagacatgcg gaactagagg
     3361 accatctctg agatcaacta ctgcaagtgg aagggtcatt gaggaatggt gctgtaggga
     3421 atgcacaatg cccccactat cgtttcgagc aaaagacggc tgctggtatg gaatggagat
     3481 aaggcccagg aaagaaccag agagcaactt agtgaggtca atggtgacag cggggtcaac
     3541 cgatcatatg gaccacttct ctcttggagt gcttgtgatt ctactcatgg tgcaggaggg
     3601 gttgaagaag agaatgacca caaagatcat catgagcaca tcaatggcag tgctggtagt
     3661 catgatcttg ggaggatttt caatgagtga cctggccaag cttgtgatcc tgatgggtgc
     3721 tactttcgca gaaatgaaca ctggaggaga tgtagctcac ttggcattgg tagcggcatt
     3781 taaagtcaga ccagccttgc tggtctcctt cattttcaga gccaattgga caccccgtga
     3841 gagcatgctg ctagccctgg cttcgtgtct tctgcaaact gcgatctctg ctcttgaagg
     3901 tgacttgatg gtcctcatta atggatttgc tttggcctgg ttggcaattc gagcaatggc
     3961 cgtgccacgc actgacaaca tcgctctacc aatcttggct gctctaacac cactagctcg
     4021 aggcacactg ctcgtggcat ggagagcggg cctggctact tgtggaggga tcatgctcct
     4081 ctccctgaaa gggaaaggta gtgtgaagaa gaacctgcca tttgtcatgg ccctgggatt
     4141 gacagctgtg agggtagtag accctattaa tgtggtagga ctactgttac tcacaaggag
     4201 tgggaagcgg agctggcccc ctagtgaagt tctcacagcc gttggcctga tatgtgcact
     4261 ggccggaggg tttgccaagg cagacattga gatggctgga cccatggctg cagtaggctt
     4321 gctaattgtc agctatgtgg tctcgggaaa gagtgtggac atgtacattg aaagagcagg
     4381 tgacatcaca tgggaaaagg acgcggaagt cactggaaac agtcctcggc ttgacgtggc
     4441 actggatgag agtggtgact tctccttggt agaggaagat ggtccaccca tgagagagat
     4501 catactcaag gtggtcctga tggccatctg tggcatgaac ccaatagcta taccttttgc
     4561 tgcaggagcg tggtatgtgt atgtgaagac tgggaaaagg agtggcgccc tctgggacgt
     4621 gcctgctccc aaagaagtga agaaaggaga gaccacagat ggagtgtaca gagtgatgac
     4681 tcgcagactg ctaggttcaa cacaggttgg agtgggagtc atgcaagagg gagtcttcca
     4741 caccatgtgg cacgttacaa aaggagccgc actgaggagc ggtgagggaa gacttgatcc
     4801 atactggggg gatgtcaagc aggacttggt gtcatactgt gggccttgga agttggatgc
     4861 agcttgggat ggactcagcg aggtacagct tttggccgta cctcccggag agagggccag
     4921 aaacattcag accctgcctg gaatattcaa gacaaaggac ggggacatcg gagcagttgc
     4981 tctggactac cctgcaggga cctcaggatc tccgatccta gacaaatgtg gaagagtgat
     5041 aggactctat ggcaatgggg ttgtgatcaa gaatggaagc tatgttagtg ctataaccca
     5101 gggaaagagg gaggaggaga ctccggttga atgtttcgaa ccctcgatgc tgaagaagaa
     5161 gcagctaact gtcttggatc tgcatccagg agccggaaaa accaggagag ttcttcctga
     5221 aatagtccgt gaagccataa aaaagagact ccggacagtg atcttggcac caactagggt
     5281 tgtcgctgct gagatggagg aggccttgag aggacttccg gtgcgttaca tgacaacagc
     5341 agtcaacgtc acccattctg ggacagaaat cgttgatttg atgtgccatg ccactttcac
     5401 ttcacgctta ctacaaccca tcagagtccc taattacaat ctcaacatca tggatgaagc
     5461 ccacttcaca gacccctcaa gtatagctgc aagaggatac atatcaacaa gggttgaaat
     5521 gggcgaggcg gctgccattt ttatgactgc cacaccacca ggaacccgtg atgcgtttcc
     5581 tgactctaac tcaccaatca tggacacaga agtggaagtc ccagagagag cctggagctc
     5641 aggctttgat tgggtgacag accattctgg gaaaacagtt tggttcgttc caagcgtgag
     5701 aaacggaaat gaaatcgcag cctgtctgac aaaggctgga aagcgggtca tacagctcag
     5761 caggaagact tttgagacag aatttcagaa aacaaaaaat caagagtggg actttgtcat
     5821 aacaactgac atctcagaga tgggcgccaa cttcaaggct gaccgggtca tagactctag
     5881 gagatgccta aaaccagtca tacttgatgg tgagagagtc atcttggctg ggcccatgcc
     5941 tgtcacgcat gctagtgctg ctcagaggag aggacgtata ggcaggaacc ctaacaaacc
     6001 tggagatgag tacatgtatg gaggtgggtg tgcagagact gatgaaggcc atgcacactg
     6061 gcttgaagca agaatgcttc ttgacaacat ctacctccag gatggcctca tagcctcgct
     6121 ctatcggcct gaggccgata aggtagccgc cattgaggga gagtttaagc tgaggacaga
     6181 gcaaaggaag accttcgtgg aactcatgaa gagaggagac cttcccgtct ggctagccta
     6241 tcaggttgca tctgccggaa taacttacac agacagaaga tggtgctttg atggcacaac
     6301 caacaacacc ataatggaag acagtgtacc agcagaggtt tggacaaagt atggagagaa
     6361 gagagtgctc aaaccgagat ggatggatgc tagggtctgt tcagaccatg cggccctgaa
     6421 gtcgttcaaa gaattcgccg ctggaaaaag aggagcggct ttgggagtaa tggaggccct
     6481 gggaacactg ccaggacaca tgacagagag gtttcaggaa gccattgaca acctcgccgt
     6541 gctcatgcga gcagagactg gaagcaggcc ttataaggca gcggcagccc aactgccgga
     6601 gaccctagag accattatgc tcttaggttt gctgggaaca gtttcactgg ggatcttctt
     6661 cgtcttgatg cggaataagg gcatcgggaa gatgggcttt ggaatggtaa cccttggggc
     6721 cagtgcatgg ctcatgtggc tttcggaaat tgaaccagcc agaattgcat gtgtcctcat
     6781 tgttgtgttt ttattactgg tggtgctcat acccgagcca gagaagcaaa gatctcccca
     6841 agataaccag atggcaatta tcatcatggt ggcagtgggc cttctaggtt tgataactgc
     6901 aaacgaactt ggatggctgg aaagaacaaa aaatgacata gctcatctaa tgggaaggag
     6961 agaagaagga gcaaccatgg gattctcaat ggacattgat ctgcggccag cctccgcctg
     7021 ggctatctat gccgcattga caactctcat caccccagct gtccaacatg cggtaaccac
     7081 ttcatacaac aactactcct taatggcgat ggccacacaa gctggagtgc tgtttggcat
     7141 gggcaaaggg atgccattta tgcatgggga ccttggagtc ccgctgctaa tgatgggttg
     7201 ctattcacaa ttaacacccc tgactctgat agtagctatc attctgcttg tggcgcacta
     7261 catgtacttg atcccaggcc tacaagcggc agcagcgcgt gctgcccaga aaaggacagc
     7321 agctggcatc atgaagaatc ccgttgtgga tggaatagtg gtaactgaca ttgacacaat
     7381 gacaatagac ccccaggtgg agaagaagat gggacaagtg ttactcatag cagtagccat
     7441 ctccagtgct gtgctgctgc ggaccgcctg gggatggggg gaggctggag ctctgatcac
     7501 agcagcgacc tccaccttgt gggaaggctc tccaaacaaa tactggaact cctctacagc
     7561 cacctcactg tgcaacatct tcagaggaag ctatctggca ggagcttccc ttatctatac
     7621 agtgacgaga aacgctggcc tggttaagag acgtggaggt gggacgggag agactctggg
     7681 agagaagtgg aaagctcgtc tgaatcagat gtcggccctg gagttctact cttataaaaa
     7741 gtcaggtatc actgaagtgt gtagagagga ggctcgccgt gccctcaagg atggagtggc
     7801 cacaggagga catgccgtat cccggggaag tgcaaagatc agatggttgg aggagagagg
     7861 atatctgcag ccctatggga aggttgttga cctcggatgt ggcagagggg gctggagcta
     7921 ttatgccgcc accatccgca aagtgcagga ggtgagagga tacacaaagg gaggtcccgg
     7981 tcatgaagaa cccatgctgg tgcaaagcta tgggtggaac atagttcgtc tcaagagtgg
     8041 agtggacgtc ttccacatgg cggctgagcc gtgtgacact ctgctgtgtg acataggtga
     8101 gtcatcatct agtcctgaag tggaagagac acgaacactc agagtgctct ctatggtggg
     8161 ggactggctt gaaaaaagac caggggcctt ctgtataaag gtgctgtgcc catacaccag
     8221 cactatgatg gaaaccatgg agcgactgca acgtaggcat gggggaggat tagtcagagt
     8281 gccattgtgt cgcaactcca cacatgagat gtactgggtc tctggggcaa agagcaacat
     8341 cataaaaagt gtgtccacca caagtcagct cctcctggga cgcatggatg gccccaggag
     8401 gccagtgaaa tatgaggagg atgtgaacct cggctcgggt acacgagctg tggcaagctg
     8461 tgctgaggct cctaacatga aaatcatcgg caggcgcatt gagagaatcc gcaatgaaca
     8521 tgcagaaaca tggtttcttg atgaaaacca cccatacagg acatgggcct accatgggag
     8581 ctacgaagcc cccacgcaag gatcagcgtc ttccctcgtg aacggggttg ttagactcct
     8641 gtcaaagcct tgggacgtgg tgactggagt tacaggaata gccatgactg acaccacacc
     8701 atacggccaa caaagagtct tcaaagaaaa agtggacacc agggtgccag atccccaaga
     8761 aggcactcgc caggtaatga acatagtctc ttcctggctg tggaaggagc tggggaaacg
     8821 caagcggcca cgcgtctgca ccaaagaaga gtttatcaac aaggtgcgca gcaatgcagc
     8881 actgggagca atatttgaag aggaaaaaga atggaagacg gctgtggaag ctgtgaatga
     8941 tccaaggttt tgggccctag tggataggga gagagaacac cacctgagag gagagtgtca
     9001 cagctgtgtg tacaacatga tgggaaaaag agaaaagaag caaggagagt tcgggaaagc
     9061 aaaaggtagc cgcgccatct ggtacatgtg gttgggagcc agattcttgg agtttgaagc
     9121 ccttggattc ttgaacgagg accattggat gggaagagaa aactcaggag gtggagtcga
     9181 agggttagga ttgcaaagac ttggatacat tctagaagaa atgaatcggg caccaggagg
     9241 aaagatgtac gcagatgaca ctgctggctg ggacacccgc attagtaagt ttgatctgga
     9301 gaatgaagct ctgattacca accaaatgga ggaagggcac agaactctgg cgttggccgt
     9361 gattaaatac acataccaaa acaaagtggt gaaggttctc agaccagctg aaggaggaaa
     9421 aacagttatg gacatcattt caagacaaga ccagagaggg agtggacaag ttgtcactta
     9481 tgctctcaac acattcacca acttggtggt gcagcttatc cggaacatgg aagctgagga
     9541 agtgttagag atgcaagact tatggttgtt gaggaagcca gagaaagtga ccagatggtt
     9601 gcagagcaat ggatgggata gactcaaacg aatggcggtc agtggagatg actgcgttgt
     9661 gaagccaatc gatgataggt ttgcacatgc cctcaggttc ttgaatgaca tgggaaaagt
     9721 taggaaagac acacaggagt ggaaaccctc gactggatgg agcaattggg aagaagtccc
     9781 gttctgctcc caccacttca acaagctgta cctcaaggat gggagatcca ttgtggtccc
     9841 ttgccgccac caagatgaac tgattggccg agctcgcgtc tcaccagggg caggatggag
     9901 catccgggag actgcctgtc ttgcaaaatc atatgcgcag atgtggcagc tcctttattt
     9961 ccacagaaga gaccttcgac tgatggctaa tgccatttgc tcggctgtgc cagttgactg
    10021 ggtaccaact gggagaacca cctggtcaat ccatggaaag ggagaatgga tgaccactga
    10081 ggacatgctc atggtgtgga atagagtgtg gattgaggag aacgaccata tggaggacaa
    10141 gactcctgta acaaaatgga cagacattcc ctatctagga aaaagggagg acttatggtg
    10201 tggatccctt atagggcaca gaccccgcac cacttgggct gaaaacatca aagacacagt
    10261 caacatggtg cgcaggatca taggtgatga agaaaagtac atggactatc tatccaccca
    10321 agtccgctac ttgggtgagg aagggtccac acccggagtg ttgtaagcac caattttagt
    10381 gttgtcaggc ctgctagtca gccacagttt ggggaaagct gtgcagcctg taaccccccc
    10441 aggagaagct gggaaaccaa gctcatagtc aggccgagaa cgccatggca cggaagaagc
    10501 catgctgcct gtgagcccct cagaggacac tgagtcaaaa aaccccacgc gcttggaagc
    10561 gcaggatggg aaaagaaggt ggcgaccttc cccacccttc aatctggggc ctgaactgga
    10621 gactagctgt gaatctccag cagagggact agtggttaga ggagaccccc cggaaaacgc
    10681 aaaacagcat attgacgtgg gaaagaccag agactccatg agtttccacc acgctggccg
    10741 ccaggcacag atcgccgaac ttcggcggcc ggtgtgggga aatccatggt ttct


ZIKA-virus genomeja selvitetty ainakin kolme toisistaan eriävää kantaa

Genome Announc. 2016 Aug 18;4(4). pii: e00800-16. doi: 10.1128/genomeA.00800-16.

Complete Genome Sequences of Three Historically Important, Spatiotemporally Distinct, and Genetically Divergent Strains of Zika Virus: MR-766, P6-740, and PRVABC-59.

Yun SI1, Song BH1, Frank JC1, Julander JG1, Polejaeva IA1, Davies CJ1, White KL1, Lee YM2

Abstract

Here, we report the 10,807-nucleotide-long consensus RNA genome sequences of three spatiotemporally distinct and genetically divergent Zika virus strains, with the functionality of their genomic sequences substantiated by reverse genetics
 MR-766 (African lineage, Uganda, 1947),
 P6-740 (Asian lineage, Malaysia, 1966),
 and PRVABC-59 (Asian lineage-derived American strain, Puerto Rico, 2015).

fredag 19 augusti 2016

Zikavirus voittaa alueita

Zikavirusta voi käytännöllisesti katsoen pitää  hyvin varhaisen dementian aiheuttavana viruksena mikrokefalian takia.  Tämä kongenitaalidementia on  kehitysvammaisuus retardatio mentalis profunda.

Irakissa runsasta siipikarjakuolemaa AIV virukseen

http://www.thepoultrysite.com/poultrynews/37376/iraqs-avian-flu-outbreaks-killing-millions-of-birds/

IRAQ - Outbreaks of a H5 strain of highly pathogenic avian influenza virus spread on farms in central Iraq in June and July.
Eleven outbreaks were reported in total, mainly affecting Baghdad but also the nearby Wasit region.
In total, 2.8 million birds died or were destroyed in the outbreaks. The source of the outbreaks is unknown.
As well as stamping out and disinfection, the country is using movement controls and surveillance measures to prevent further spread.
Sodan,  nälänhädän, kuivuuden, pakolaisvirtojen lisäksi  siipikarjan suurimitainen kuolema on paha isku väestölle. Saati sitten se  vaara, että uusi pandemiavirus  lähtee vähitellen ihmiskunnan puolelle tuosta kurjuuden myräkästä.

fredag 20 maj 2016

Lancet kirjoittaa Zika viruksesta 20.5. 2016

Rarely have scientists engaged with a new research agenda with such a sense of urgency and from such a small knowledge base as in the current epidemic of microcephaly (6000 notified suspected cases in Brazil1 and the first case detected in Colombia in March, 20162) associated with the Zika virus outbreak across the Americas. Indeed, in 2015, in a review of infections that have neurological consequences, Zika virus was not even mentioned.3 In only 5 months since the detection of the first excess cases of microcephaly in Brazil,4 WHO has declared the clusters of microcephaly and other neurological disorders to be a Public Health Emergency of International Concern.5 WHO had also stated that the causal relation of these disorders with Zika virus infection had not yet been scientifically proven.5 The reluctance to accept the causal link stems from the rarity of isolation of Zika virus or detection of RNA in neonates with microcephaly.1
Before the outbreak of Zika virus in the Americas, the largest documented outbreak was in French Polynesia in 2013–14. An elegant piece of evidence supporting the theory that Zika is the cause of microcephaly comes from that outbreak. In the first investigation, no peak in the number of fetuses or neonates with microcephaly was detected.6 The theory that mother-to-child Zika virus infection was a cause of the microcephaly epidemic in Brazil, however, required that there had been an increase in microcephaly associated with the Zika outbreak in French Polynesia. Further investigation identified 17 cases of severe neurological malformations, including microcephaly, and showed that a peak had been missed because most women had terminations.7
In The Lancet, Simon Cauchemez and colleagues8 present a reanalysis of the data on Zika and microcephaly from the French Polynesian outbreak to estimate the magnitude of risk in women infected with Zika virus during pregnancy. They used serological data to estimate the total number of infections during the outbreak and data from surveillance on consultations for suspected Zika virus disease to attribute these infections to the weeks of the outbreak. They did an exhaustive search of medical records to identify all cases of microcephaly during the period Sept 1, 2013, to July 31, 2015. Eight cases of microcephaly were identified, seven of which occurred in a 4-month period around the end of the Zika virus outbreak. The baseline prevalence of microcephaly was two (95% CI 0–8) per 10 000 neonates. The researchers developed a mathematical model with six periods of assumed increased risk of microcephaly given Zika infection to investigate when the risk of infection and the magnitude of the risk were greatest. The period of risk with the best fit was infection in the first trimester of pregnancy. The risk of microcephaly associated with Zika virus infection was 95 (34–191) per 10 000 women infected in the first trimester: essentially a risk of microcephaly for infection in the first trimester of around 1% (0·3–1·9)
The finding that the highest risk of microcephaly was associated with infection in the first trimester of pregnancy is biologically plausible, given the timing of brain development and the type and severity of the neurological abnormalities.9 However, the absolute risk of 1% estimated by Cauchemez and colleagues is perhaps lower than expected. In the state of Pernambuco, Brazil, where the risk was highest, during the 4 months of the epidemic 2% of all neonates were notified as suspected cases of microcephaly, not only those born to women known to have been infected.4 Half of the suspected cases were confirmed by the presence of calcifications, other brain abnormalities, or both.4 How to interpret the data has been the subject of some debate.10
After the paper by Cauchemez and colleagues8 was written, Brasil and colleagues11 reported preliminary results for 72 pregnant women with symptomatic, laboratory-confirmed Zika virus infections, recruited in Rio de Janeiro before fetal outcomes were known. Ultrasound images were available for 42 women, of which 12 (29%) showed abnormalities over the range of gestational ages at infection.11 Nine women had rash and viraemia in the first trimester, and microcephaly was detected by ultrasonography in two of these, which corresponds to 22% risk of microcephaly after symptomatic Zika infection in the first trimester.11
Thumbnail image of Figure. Opens large image
Boris Roessler/epa/Corbis
These three different approaches addressed different questions: the risk in all neonates during the epidemic in Pernambuco4 and the risk in neonates from women infected with Zika virus in the first trimester of pregnancy in the other two studies (with clinical symptoms in Rio de Janeiro11 and independently of clinical symptoms in French Polynesia8). As expected the estimates are different, but are they consistent with a single underlying risk or, alternatively, will risk be dependent on other factors, such as the presence of clinical symptoms or previous dengue infection? Further data will soon be available from Pernambuco, Colombia, Rio de Janeiro, and maybe other sites that will gradually answer these questions. The fast production of knowledge during this epidemic is an opportunity to observe science in the making: from formulation of new hypotheses and production of new results that will provide confirmations and contradictions to the refinement of methods and the gradual building of consensus. I expect we will teach our students about the production of science using examples from this Public Health Emergency of International Concern for many years to come.
I declare no competing interests.

References

  1. Teixeira, MG, Costa, MCN, de Oliveira, WK, Nunes, ML, and Rodrigues, LC. The epidemic of Zika virus-related microcephaly in Brazil: detection, control, etiology, and future scenarios. Am J Public Health. 2016; 106: 601–605
  2. Butler, D. First Zika-linked birth defects detected in Colombia. Nature. 2016; 531: 153
  3. John, CC, Carabin, H, Montano, SM et al. Global research priorities for infections that affect the nervous system. Nature. 2015; 527: S178–S186
  4. Centro de Operações de Emergências em Saúde Pública Sobre Microcefalias. Informe epidemiológico no 15–semana epidemiológica(SE)08/2016(21A 27/02/2016). http://combateaedes.saude.gov.br/images/pdf/informe_microcefalia_epidemiologico15.pdf; Aug 8, 2016. ((accessed March 3, 2016).)
  5. WHO. WHO Director-General summarizes the outcome of the Emergency Committee regarding clusters of microcephaly and Guillain-Barré syndrome. http://www.who.int/mediacentre/news/statements/2016/emergency-committee-zika-microcephaly/en/#; Feb 1, 2016. ((accessed March 3, 2016).)
  6. Mallet, HP, Vial, AL, and Nusso, D. Bilan de l'epidemie a virus Zika en Polynesie Francaise, 2013–2014. Bull Inf Sanit Epidemiol Stat. 2015; 13: 1–5
  7. Centre D'Hygiene et de Salubrite Publique. Note sur les investigations autour des malformations cérébrales congénitales ayant suivi l'épidémie de zika de 2013–2014. http://www.hygiene-publique.gov.pf/IMG/pdf/note_malformations_congenitales_cerebrales; December, 2015. ((accessed Dec 1, 2015).)
  8. Cauchemez, S, Besnard, M, Bompard, P et al. Association between Zika virus and microcephaly in French Polynesia, 2013–15: a retrospective study. Lancet. 2016; (published online March 15.)http://dx.doi.org/10.1016/S0140-6736(16)00651-6.
  9. Schuler-Faccini, L, Ribeiro, EM, Feitosa, IM et al. Possible association between Zika vírus infection and microcephaly—Brazil, 2015. MMWR Morb Mortal Wkly Rep. 2016; 65: 59–62
  10. Victora, CG, Schuler-Faccini, L, Matijasevich, A, Ribeiro, E, Pessoa, A, and Barros, FC. Microcephaly in Brazil: how to interpret reported numbers?. Lancet. 2016; 387: 621–624
  11. Brasil, P, Pereira, JP Jr, Gabaglia, CR et al. Zika virus infection in pregnant women in Rio de Janeiro—preliminary report. N Engl J Med. 2016; DOI: http://dx.doi.org/10.1056/NEJMoa1602412 (published online March 4.)